PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_13932.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 332aa    MW: 36726.5 Da    PI: 6.9389
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_13932.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.11.5e-52341621128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                   lppGfrFhPtdeelv++yL++kv + ++    v i+evd++++ePwdLp++++ +e+ewyfFs rd+ky+tg r+nrat +gyWkatgkd+evl++ 
  MLOC_13932.1  34 LPPGFRFHPTDEELVTFYLAAKVFNGTCCG-GVdIAEVDLNRCEPWDLPEAARMGEREWYFFSLRDRKYPTGLRTNRATGAGYWKATGKDREVLNAa 129
                   79*************************888.455***************9888999**************************************987 PP

           NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                   +g+l g+kktLvfy+grap+gekt+Wv+heyrl
  MLOC_13932.1 130 TGSLLGMKKTLVFYRGRAPRGEKTKWVLHEYRL 162
                   8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6225185IPR003441NAC domain
PROSITE profilePS5100558.75634185IPR003441NAC domain
PfamPF023654.2E-2735162IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MHQHQPAAAM GDALWELIGE EMAAAEAAAG EHGLPPGFRF HPTDEELVTF YLAAKVFNGT  60
CCGGVDIAEV DLNRCEPWDL PEAARMGERE WYFFSLRDRK YPTGLRTNRA TGAGYWKATG  120
KDREVLNAAT GSLLGMKKTL VFYRGRAPRG EKTKWVLHEY RLDGDFGAVR RSCKEEWVVC  180
RIFHKAVDQY SKMMEMRNPY CYFPMTPHHP SFFQDAPPVP FPNPSQLIPF HHDLPHLQSS  240
PLIQGQAKNT SNNSNGGFPA AASIQEQPNS SCNPAYFPFP SFASIVNGKA GPPAQPGVNG  300
GPQEPPPTWL DACLQHSAFM YEMGPPAATR GA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-49221853168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00241DAPTransfer from AT1G76420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3754320.0AK375432.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3094D13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648828.11e-160PREDICTED: protein CUP-SHAPED COTYLEDON 3
SwissprotQ9S8514e-87NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLF2EH050.0F2EH05_HORVD; Predicted protein (Fragment)
STRINGMLOC_13932.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112373341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.13e-85NAC family protein